SNX12 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
SNX12 MaxPab polyclonal antibody. Western Blot analysis of SNX12 expression in PC-12.
Western Blot (Cell lysate)
SNX12 MaxPab polyclonal antibody. Western Blot analysis of SNX12 expression in Raw 264.7.
Western Blot (Cell lysate)
SNX12 MaxPab polyclonal antibody. Western Blot analysis of SNX12 expression in K-562.
Western Blot (Transfected lysate)
Western Blot analysis of SNX12 expression in transfected 293T cell line (H00029934-T01) by SNX12 MaxPab polyclonal antibody.
Lane 1: SNX12 transfected lysate(18.92 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human SNX12 protein.
Immunogen
SNX12 (AAH20559, 1 a.a. ~ 172 a.a) full-length human protein.
Sequence
MSDTAVADTRRLNSKPQDLTDAYGPPSNFLEIDIFNPQTVGVGRARFTTYEVRMRTNLPIFKLKESCVRRRYSDFEWLKNELERDSKIVVPPLPGKALKRQLPFRGDEGIFEESFIEERRQGLEQFINKIAGHPLAQNERCLHMFLQEEAIDRNYVPGKSLAVSCPGWSAVA
Host
Mouse
Reactivity
Human, Mouse, Rat
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
SNX12 MaxPab polyclonal antibody. Western Blot analysis of SNX12 expression in PC-12.Western Blot (Cell lysate)
SNX12 MaxPab polyclonal antibody. Western Blot analysis of SNX12 expression in Raw 264.7.Western Blot (Cell lysate)
SNX12 MaxPab polyclonal antibody. Western Blot analysis of SNX12 expression in K-562.Western Blot (Transfected lysate)
Western Blot analysis of SNX12 expression in transfected 293T cell line (H00029934-T01) by SNX12 MaxPab polyclonal antibody.
Lane 1: SNX12 transfected lysate(18.92 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — SNX12
Entrez GeneID
29934GeneBank Accession#
BC020559Protein Accession#
AAH20559Gene Name
SNX12
Gene Alias
MGC118982, MGC118983
Gene Description
sorting nexin 12
Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This protein does not contain a coiled coil region, like some family members. This gene encodes a protein of unknown function. [provided by RefSeq
Other Designations
OTTHUMP00000023487
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com