SNX11 monoclonal antibody (M05), clone 2G1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of SNX11 expression in transfected 293T cell line by SNX11 monoclonal antibody (M05), clone 2G1.
Lane 1: SNX11 transfected lysate(30.4 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of SNX11 transfected lysate using anti-SNX11 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with SNX11 MaxPab rabbit polyclonal antibody.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SNX11 is 0.3 ng/ml as a capture antibody.
Western Blot detection against Immunogen (55.44 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant SNX11.
Immunogen
SNX11 (AAH00768, 1 a.a. ~ 270 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MGFWCRMSENQEQEEVITVRVQDPRVQNEGSWNSYVDYKIFLHTNSKAFTAKTSCVRRRYREFVWLRKQLQRNAGLVPVPELPGKSTFFGTSDEFIEKRRQGLQHFLEKVLQSVVLLSDSQLHLFLQSQLSVPEIEACVQGRSTMTVSDAILRYAMSNCGWAQEERQSSSHLAKGDQPKSCCFLPRSGRRSSPSPPPSEEKDHLEVWAPVVDSEVPSLESPTLPPLSSPLCCDFGRPKEGTSTLQSVRRAVGGDHAVPLDPGQLETVLEK
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (55.44 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of SNX11 expression in transfected 293T cell line by SNX11 monoclonal antibody (M05), clone 2G1.
Lane 1: SNX11 transfected lysate(30.4 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunoprecipitation
Immunoprecipitation of SNX11 transfected lysate using anti-SNX11 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with SNX11 MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SNX11 is 0.3 ng/ml as a capture antibody.ELISA
-
Gene Info — SNX11
Entrez GeneID
29916GeneBank Accession#
BC000768Protein Accession#
AAH00768Gene Name
SNX11
Gene Alias
MGC111019
Gene Description
sorting nexin 11
Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This protein does not contain a coiled coil region, like some family members. This gene encodes a protein of unknown function. This gene results in two transcript variants differing in the 5' UTR, but encoding the same protein. [provided by RefSeq
Other Designations
-
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com