SNX11 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human SNX11 protein.
Immunogen
SNX11 (AAH00768, 1 a.a. ~ 270 a.a) full-length human protein.
Sequence
MGFWCRMSENQEQEEVITVRVQDPRVQNEGSWNSYVDYKIFLHTNSKAFTAKTSCVRRRYREFVWLRKQLQRNAGLVPVPELPGKSTFFGTSDEFIEKRRQGLQHFLEKVLQSVVLLSDSQLHLFLQSQLSVPEIEACVQGRSTMTVSDAILRYAMSNCGWAQEERQSSSHLAKGDQPKSCCFLPRSGRRSSPSPPPSEEKDHLEVWAPVVDSEVPSLESPTLPPLSSPLCCDFGRPKEGTSTLQSVRRAVGGDHAVPLDPGQLETVLEK
Host
Rabbit
Reactivity
Human, Mouse
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
SNX11 MaxPab rabbit polyclonal antibody. Western Blot analysis of SNX11 expression in mouse liver.Western Blot (Tissue lysate)
SNX11 MaxPab rabbit polyclonal antibody. Western Blot analysis of SNX11 expression in human liver.Western Blot (Cell lysate)
SNX11 MaxPab rabbit polyclonal antibody. Western Blot analysis of SNX11 expression in HepG2.Western Blot (Transfected lysate)
Western Blot analysis of SNX11 expression in transfected 293T cell line (H00029916-T01) by SNX11 MaxPab polyclonal antibody.
Lane 1: SNX11 transfected lysate(29.81 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — SNX11
Entrez GeneID
29916GeneBank Accession#
BC000768Protein Accession#
AAH00768Gene Name
SNX11
Gene Alias
MGC111019
Gene Description
sorting nexin 11
Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This protein does not contain a coiled coil region, like some family members. This gene encodes a protein of unknown function. This gene results in two transcript variants differing in the 5' UTR, but encoding the same protein. [provided by RefSeq
Other Designations
-
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com