CNOT7 monoclonal antibody (M01A), clone 2F6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant CNOT7.
Immunogen
CNOT7 (AAH60852, 1 a.a. ~ 285 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MPAATVDHSQRICEVWACNLDEEMKKIRQVIRKYNYVAMDTEFPGVVARPIGEFRSNADYQYQLLRCNVDLLKIIQLGLTFMNEQGEYPPGTSTWQFNFKFNLTEDMYAQDSIELLTTSGIQFKKHEEEGIETQYFAELLMTSGVVLCEGVKWLSFHSGYDFGYLIKILTNSNLPEEELDFFEILRLFFPVIYDVKYLMKSCKNLKGGLQEVAEQLELERIGPQHQAGSDSLLTGMAFFKMREMFFEDHIDDAKYCGHLYGLGSGSSYVQNGTGNAYEEEANKQS
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (99); Rat (99)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (57.09 KDa) .
Storage Buffer
In ascites fluid
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
CNOT7 monoclonal antibody (M01A), clone 2F6. Western Blot analysis of CNOT7 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Cell lysate)
CNOT7 monoclonal antibody (M01A), clone 2F6 Western Blot analysis of CNOT7 expression in HeLa ( Cat # L013V1 ).Western Blot (Cell lysate)
CNOT7 monoclonal antibody (M01A), clone 2F6. Western Blot analysis of CNOT7 expression in Raw 264.7 ( Cat # L024V1 ).Western Blot (Cell lysate)
CNOT7 monoclonal antibody (M01A), clone 2F6. Western Blot analysis of CNOT7 expression in PC-12 ( Cat # L012V1 ).Western Blot (Cell lysate)
CNOT7 monoclonal antibody (M01A), clone 2F6. Western Blot analysis of CNOT7 expression in NIH/3T3 ( Cat # L018V1 ).Western Blot (Recombinant protein)
ELISA
-
Gene Info — CNOT7
Entrez GeneID
29883GeneBank Accession#
BC060852Protein Accession#
AAH60852Gene Name
CNOT7
Gene Alias
CAF1, hCAF-1
Gene Description
CCR4-NOT transcription complex, subunit 7
Omim ID
604913Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene binds to an anti-proliferative protein, B-cell translocation protein 1, which negatively regulates cell proliferation. Binding of the two proteins, which is driven by phosphorylation of the anti-proliferative protein, causes signaling events in cell division that lead to changes in cell proliferation associated with cell-cell contact. The protein has both mouse and yeast orthologs. Alternate splicing of this gene results in two transcript variants encoding different isoforms. [provided by RefSeq
Other Designations
BTG1 binding factor 1|carbon catabolite repressor protein (CCR4)-associative factor 1
-
Interactome
-
Pathway
-
Publication Reference
-
CNOT7 outcompetes its paralog CNOT8 for integration into the CCR4-NOT complex.
Patrick N Stoney, Akiko Yanagiya, Saori Nishijima, Tadashi Yamamoto.
Journal of Molecular Biology 2022 Mar; 434(9):167523.
Application:WB-Ti, WB-Tr, Mouse, Mouse brain, Mouse heart, Mouse hippocampus, Mouse kidney, Mouse liver, Mouse lung, Mouse muscle, Mouse testis, Mouse white adipose tissue, N2a cells, Recombinant proteins.
-
CNOT7 outcompetes its paralog CNOT8 for integration into the CCR4-NOT complex.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com