CNOT7 monoclonal antibody (M01), clone 2F6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
CNOT7 monoclonal antibody (M01), clone 2F6 Western Blot analysis of CNOT7 expression in HeLa ( Cat # L013V1 ).
Western Blot (Cell lysate)
CNOT7 monoclonal antibody (M01), clone 2F6. Western Blot analysis of CNOT7 expression in NIH/3T3 ( Cat # L018V1 ).
Western Blot (Cell lysate)
CNOT7 monoclonal antibody (M01), clone 2F6. Western Blot analysis of CNOT7 expression in Raw 264.7 ( Cat # L024V1 ).
Western Blot (Cell lysate)
CNOT7 monoclonal antibody (M01), clone 2F6. Western Blot analysis of CNOT7 expression in Hela S3 NE ( Cat # L013V3 ).
Western Blot (Cell lysate)
CNOT7 monoclonal antibody (M01), clone 2F6. Western Blot analysis of CNOT7 expression in PC-12 ( Cat # L012V1 ).
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CNOT7 is 3 ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to CNOT7 on HeLa cell. [antibody concentration 40 ug/ml]
Western Blot detection against Immunogen (57.09 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant CNOT7.
Immunogen
CNOT7 (AAH60852, 1 a.a. ~ 285 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MPAATVDHSQRICEVWACNLDEEMKKIRQVIRKYNYVAMDTEFPGVVARPIGEFRSNADYQYQLLRCNVDLLKIIQLGLTFMNEQGEYPPGTSTWQFNFKFNLTEDMYAQDSIELLTTSGIQFKKHEEEGIETQYFAELLMTSGVVLCEGVKWLSFHSGYDFGYLIKILTNSNLPEEELDFFEILRLFFPVIYDVKYLMKSCKNLKGGLQEVAEQLELERIGPQHQAGSDSLLTGMAFFKMREMFFEDHIDDAKYCGHLYGLGSGSSYVQNGTGNAYEEEANKQS
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (99); Rat (99)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (57.09 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
CNOT7 monoclonal antibody (M01), clone 2F6 Western Blot analysis of CNOT7 expression in HeLa ( Cat # L013V1 ).Western Blot (Cell lysate)
CNOT7 monoclonal antibody (M01), clone 2F6. Western Blot analysis of CNOT7 expression in NIH/3T3 ( Cat # L018V1 ).Western Blot (Cell lysate)
CNOT7 monoclonal antibody (M01), clone 2F6. Western Blot analysis of CNOT7 expression in Raw 264.7 ( Cat # L024V1 ).Western Blot (Cell lysate)
CNOT7 monoclonal antibody (M01), clone 2F6. Western Blot analysis of CNOT7 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Cell lysate)
CNOT7 monoclonal antibody (M01), clone 2F6. Western Blot analysis of CNOT7 expression in PC-12 ( Cat # L012V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CNOT7 is 3 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to CNOT7 on HeLa cell. [antibody concentration 40 ug/ml] -
Gene Info — CNOT7
Entrez GeneID
29883GeneBank Accession#
BC060852Protein Accession#
AAH60852Gene Name
CNOT7
Gene Alias
CAF1, hCAF-1
Gene Description
CCR4-NOT transcription complex, subunit 7
Omim ID
604913Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene binds to an anti-proliferative protein, B-cell translocation protein 1, which negatively regulates cell proliferation. Binding of the two proteins, which is driven by phosphorylation of the anti-proliferative protein, causes signaling events in cell division that lead to changes in cell proliferation associated with cell-cell contact. The protein has both mouse and yeast orthologs. Alternate splicing of this gene results in two transcript variants encoding different isoforms. [provided by RefSeq
Other Designations
BTG1 binding factor 1|carbon catabolite repressor protein (CCR4)-associative factor 1
-
Interactome
-
Pathway
-
Publication Reference
-
Regulation of CCR4-NOT complex deadenylase activity and cellular responses by MK2-dependent phosphorylation of CNOT2.
Toru Suzuki, Miyuki Hoshina, Saori Nishijima, Naosuke Hoshina, Chisato Kikuguchi, Takumi Tomohiro, Akira Fukao, Toshinobu Fujiwara, and Tadashi Yamamoto.
RNA Biology 2022 Jan; 19(1):234.
Application：WB, Human, HeLa cells.
-
Neuronal XRN1 is required for maintenance of whole-body metabolic homeostasis.
Shohei Takaoka, Akiko Yanagiya, Haytham Mohamed Aly Mohamed, Rei Higa, Takaya Abe, Ken-Ichi Inoue, Akinori Takahashi, Patrick Stoney, Tadashi Yamamoto.
iScience 2021 Sep; 24(10):103151.
Application：WB-Ti, Mouse, Mouse hypothalamus.
-
PABP Cooperates with the CCR4-NOT Complex to Promote mRNA Deadenylation and Block Precocious Decay.
Yi H, Park J, Ha M, Lim J, Chang H, Kim VN.
Molecular Cell 2018 Jun; 70(6):1081.
Application：WB-Tr, Human, HeLa cells.
-
Phase Transitions in the Assembly and Function of Human miRISC.
Sheu-Gruttadauria J, MacRae IJ.
Cell 2018 May; 173(4):946.
Application：WB-Ce, Human, HEK 293 cells.
-
CNOT3 contributes to early B cell development by controlling Igh rearrangement and p53 mRNA stability.
Inoue T, Morita M, Hijikata A, Fukuda-Yuzawa Y, Adachi S, Isono K, Ikawa T, Kawamoto H, Koseki H, Natsume T, Fukao T, Ohara O, Yamamoto T, Kurosaki T.
The journal of Experimental Medicine 2015 Aug; 212(9):1465.
Application：WB-Ce, Mouse, Bone marrow cells(pre-pro-B, pro-B, pre-B, immature B), recirculating B cells.
-
miRNA repression involves GW182-mediated recruitment of CCR4-NOT through conserved W-containing motifs.
Chekulaeva M, Mathys H, Zipprich JT, Attig J, Colic M, Parker R, Filipowicz W.
Nature Structural & Molecular Biology 2011 Oct; 18(11):1218.
Application：WB-Tr, Human, HEK293T cells.
-
Regulation of CCR4-NOT complex deadenylase activity and cellular responses by MK2-dependent phosphorylation of CNOT2.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com