VPREB3 monoclonal antibody (M08), clone 4H8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of VPREB3 expression in transfected 293T cell line by VPREB3 monoclonal antibody (M08), clone 4H8.
Lane 1: VPREB3 transfected lysate(13.7 KDa).
Lane 2: Non-transfected lysate.
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant VPREB3.
Immunogen
VPREB3 (NP_037510, 24 a.a. ~ 123 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
QLDALLVFPGQVAQLSCTLSPQHVTIRDYGVSWYQQRAGSAPRYLLYYRSEEDHHRPADIPDRFSAAKDEAHNACVLTISPVQPEDDADYYCSVGYGFSP
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of VPREB3 expression in transfected 293T cell line by VPREB3 monoclonal antibody (M08), clone 4H8.
Lane 1: VPREB3 transfected lysate(13.7 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
ELISA
-
Gene Info — VPREB3
Entrez GeneID
29802GeneBank Accession#
NM_013378Protein Accession#
NP_037510Gene Name
VPREB3
Gene Alias
8HS20, N27C7-2
Gene Description
pre-B lymphocyte 3
Omim ID
605017Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is the human homolog of the mouse VpreB3 (8HS20) protein, and is specifically expressed in cell lines representative of all stages of B-cell differentiation. It is also related to VPREB1 and other members of the immunoglobulin supergene family. This protein associates with membrane mu heavy chains early in the course of pre-B cell receptor biosynthesis. The precise function of the protein is not known, but it may contribute to mu chain transport in pre-B cells. [provided by RefSeq
Other Designations
pre-B lymphocyte gene 3
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com