VPREB3 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human VPREB3 protein.
Immunogen
VPREB3 (NP_037510.1, 1 a.a. ~ 123 a.a) full-length human protein.
Sequence
MACRCLSFLLMGTFLSVSQTVLAQLDALLVFPGQVAQLSCTLSPQHVTIRDYGVSWYQQRAGSAPRYLLYYRSEEDHHRPADIPDRFSAAKDEAHNACVLTISPVQPEDDADYYCSVGYGFSP
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of VPREB3 expression in transfected 293T cell line (H00029802-T02) by VPREB3 MaxPab polyclonal antibody.
Lane 1: VPREB3 transfected lysate(13.53 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of purified MaxPab antibody to VPREB3 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3 ug/ml] -
Gene Info — VPREB3
Entrez GeneID
29802GeneBank Accession#
NM_013378.1Protein Accession#
NP_037510.1Gene Name
VPREB3
Gene Alias
8HS20, N27C7-2
Gene Description
pre-B lymphocyte 3
Omim ID
605017Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is the human homolog of the mouse VpreB3 (8HS20) protein, and is specifically expressed in cell lines representative of all stages of B-cell differentiation. It is also related to VPREB1 and other members of the immunoglobulin supergene family. This protein associates with membrane mu heavy chains early in the course of pre-B cell receptor biosynthesis. The precise function of the protein is not known, but it may contribute to mu chain transport in pre-B cells. [provided by RefSeq
Other Designations
pre-B lymphocyte gene 3
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com