Product Browser

Last updated: 2017/10/22

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

UCRC (Human) Recombinant Protein (P01)

  • Catalog # : H00029796-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human UCRC full-length ORF ( AAH05402, 1 a.a. - 63 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MAAATLTSKLYSLLFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 32.67
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00029796-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • UCRC
  • Gene Alias:
  • HSPC051,HSPC119,HSPC151
  • Gene Description:
  • ubiquinol-cytochrome c reductase complex (7.2 kD)
  • Gene Summary:
  • UCRC is a subunit of mitochondrial complex III (ubiquinol-cytochrome c reductase; EC 1.10.2.2), which forms the middle segment of the respiratory chain of the inner mitochondrial membrane (Schagger et al., 1995 [PubMed 8592474]).[supplied by OMIM
  • Other Designations:
  • 7.2kDa cytochrome c1-associated protein subunit,complex III subunit X,cytochrome C1, nonheme 7kDa protein,ubiquinol-cytochrome c reductase complex 7.2kDa protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook