Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TMOD2 MaxPab rabbit polyclonal antibody (D01)MaxPab

  • Catalog # : H00029767-D01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human TMOD2 protein.
  • Immunogen:
  • TMOD2 (NP_055363.1, 1 a.a. ~ 351 a.a) full-length human protein.
  • Sequence:
  • MALPFQKELEKYKNIDEDELLGKLSEEELKQLENVLDDLDPESAMLPAGFRQKDQTQKAATGPFDREHLLMYLEKEALEQKDREDFVPFTGEKKGRVFIPKEKPIETRKEEKVTLDPELEEALASASDTELYDLAAVLGVHNLLNNPKFDEETANNKGGKGPVRNVVKGEKVKPVFEEPPNPTNVEISLQQMKANDPSLQEVNLNNIKNIPIPTLREFAKALETNTHVKKFSLAATRSNDPVAIAFADMLKVNKTLTSLNIESNFITGTGILALVEALKENDTLTEIKIDNQRQQLGTAVEMEIAQMLEENSRILKFGYQFTKQGPRTRVAAAITKNNDLVRKKRVEADRR
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • TMOD2 MaxPab rabbit polyclonal antibody. Western Blot analysis of TMOD2 expression in human pancreas.
  • PDF DownloadProtocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of TMOD2 expression in transfected 293T cell line (H00029767-T03) by TMOD2 MaxPab polyclonal antibody.

    Lane 1: TMOD2 transfected lysate(39.6 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Immunoprecipitation
  • Immunoprecipitation
  • Immunoprecipitation of TMOD2 transfected lysate using anti-TMOD2 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with TMOD2 purified MaxPab mouse polyclonal antibody (B01P) (H00029767-B01P).
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • TMOD2
  • Gene Alias:
  • MGC39481,N-TMOD,NTMOD
  • Gene Description:
  • tropomodulin 2 (neuronal)
  • Gene Summary:
  • This gene encodes a neuronal-specific member of the tropomodulin family of actin-regulatory proteins. The encoded protein caps the pointed end of actin filaments preventing both elongation and depolymerization. The capping activity of this protein is dependent on its association with tropomyosin. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq
  • Other Designations:
  • neuronal tropomodulin
  • RSS
  • YouTube
  • Linkedin
  • Facebook