UHRF1 monoclonal antibody (M02), clone 3B12
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant UHRF1.
Immunogen
UHRF1 (NP_037414, 694 a.a. ~ 793 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
WNEVLASLKDRPASGSPFQLFLSKVEETFQCICCQELVFRPITTVCQHNVCKDCLDRSFRAQVFSCPACRYDLGRSYAMQVNQPLQTVLNQLFPGYGNGR
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (73); Rat (75)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
UHRF1 monoclonal antibody (M02), clone 3B12 Western Blot analysis of UHRF1 expression in MCF-7 ( Cat # L046V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged UHRF1 is approximately 1ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to UHRF1 on MCF-7 cell . [antibody concentration 10 ug/ml] -
Gene Info — UHRF1
Entrez GeneID
29128GeneBank Accession#
NM_013282Protein Accession#
NP_037414Gene Name
UHRF1
Gene Alias
FLJ21925, ICBP90, MGC138707, Np95, RNF106, hNP95
Gene Description
ubiquitin-like with PHD and ring finger domains 1
Omim ID
607990Gene Ontology
HyperlinkGene Summary
This gene encodes a member of a subfamily of RING-finger type E3 ubiquitin ligases. The protein binds to specific DNA sequences, and recruits a histone deacetylase to regulate gene expression. Its expression peaks at late G1 phase and continues during G2 and M phases of the cell cycle. It plays a major role in the G1/S transition by regulating topoisomerase IIalpha and retinoblastoma gene expression, and functions in the p53-dependent DNA damage checkpoint. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
E3 ubiquitin-protein ligase UHRF1|RING finger protein 106|inverted CCAAT box-binding protein of 90 kDa|nuclear zinc finger protein Np95|transcription factor ICBP90|ubiquitin-like, containing PHD and RING finger domains, 1
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com