UHRF1 monoclonal antibody (M01J), clone 3A11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant UHRF1.
This product is belong to Cell Culture Grade Antibody (CX Grade).Immunogen
UHRF1 (NP_037414.1, 694 a.a. ~ 793 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
WNEVLASLKDRPASGSPFQLFLSKVEETFQCICCQELVFRPITTVCQHNVCKDCLDRSFRAQVFSCPACRYDLGRSYAMQVNQPLQTVLNQLFPGYGNGR
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (73); Rat (75)
Preparation Method
Cell Culture Production
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
UHRF1 monoclonal antibody (M01J), clone 3A11. Western Blot analysis of UHRF1 expression in Hela S3 NE.Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged UHRF1 is 1 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to UHRF1 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — UHRF1
Entrez GeneID
29128GeneBank Accession#
NM_013282.1Protein Accession#
NP_037414.1Gene Name
UHRF1
Gene Alias
FLJ21925, ICBP90, MGC138707, Np95, RNF106, hNP95
Gene Description
ubiquitin-like with PHD and ring finger domains 1
Omim ID
607990Gene Ontology
HyperlinkGene Summary
This gene encodes a member of a subfamily of RING-finger type E3 ubiquitin ligases. The protein binds to specific DNA sequences, and recruits a histone deacetylase to regulate gene expression. Its expression peaks at late G1 phase and continues during G2 and M phases of the cell cycle. It plays a major role in the G1/S transition by regulating topoisomerase IIalpha and retinoblastoma gene expression, and functions in the p53-dependent DNA damage checkpoint. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
E3 ubiquitin-protein ligase UHRF1|RING finger protein 106|inverted CCAAT box-binding protein of 90 kDa|nuclear zinc finger protein Np95|transcription factor ICBP90|ubiquitin-like, containing PHD and RING finger domains, 1
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com