Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CD274 monoclonal antibody (M08), clone 1C10

  • Catalog # : H00029126-M08
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant CD274.
  • Immunogen:
  • CD274 (AAH74984.1, 18 a.a. ~ 238 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • AFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNER
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2b Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00029126-M08
    Western Blot detection against Immunogen (26.51 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • CD274
  • Gene Alias:
  • B7-H,B7H1,MGC142294,MGC142296,PD-L1,PDCD1L1,PDCD1LG1,PDL1
  • Gene Description:
  • CD274 molecule
  • Other Designations:
  • CD274 antigen,OTTHUMP00000021029,programmed cell death 1 ligand 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook