Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

LGALS13 purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00029124-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human LGALS13 protein.
  • Immunogen:
  • LGALS13 (AAH66304.1, 1 a.a. ~ 139 a.a) full-length human protein.
  • Sequence:
  • MSSLPVPYKLPVSLSVGSCVIIKGTPIHSFINDPQLQVDFYTDMDEDSDIAFRFRVHFGNHVVMNRREFGIWMLEETTDYVPFEDGKQFELCIYVHYNEYEIKVNGIRIYGFVHRIPPSFVKMVQVSRDISLTSVCVCN
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of LGALS13 expression in transfected 293T cell line (H00029124-T01) by LGALS13 MaxPab polyclonal antibody.

    Lane1:LGALS13 transfected lysate(15.29 KDa).
    Lane2:Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • LGALS13
  • Gene Alias:
  • GAL13,PLAC8,PP13
  • Gene Description:
  • lectin, galactoside-binding, soluble, 13
  • Gene Summary:
  • Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids. The protein encoded by this gene has lysophospholipase activity. It is composed of two identical subunits which are held together by disulfide bonds. This protein has structural similarity to several members of the beta-galactoside-binding S-type lectin family. [provided by RefSeq
  • Other Designations:
  • galectin 13,galectin-13,placental protein 13
  • RSS
  • YouTube
  • Linkedin
  • Facebook