NXT1 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of NXT1 expression in transfected 293T cell line (H00029107-T02) by NXT1 MaxPab polyclonal antibody.
Lane 1: NXT1 transfected lysate(15.51 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human NXT1 protein.
Immunogen
NXT1 (AAH00759.1, 1 a.a. ~ 140 a.a) full-length human protein.
Sequence
MASVDFKTYVDQACRAAEEFVNVYYTTMDKRRRLLSRLYMGTATLVWNGNAVSGQESSSEFFEMLPSSEFQISVVDCQPVHDEATPSQTTVLVVICGSVKFEGNKQRDFNQNFILTAQASPSNTVWKIASDCFRFQDWAS
Host
Rabbit
Reactivity
Human
Interspecies Antigen Sequence
Mouse (97); Rat (97)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of NXT1 expression in transfected 293T cell line (H00029107-T02) by NXT1 MaxPab polyclonal antibody.
Lane 1: NXT1 transfected lysate(15.51 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — NXT1
Entrez GeneID
29107GeneBank Accession#
BC000759.1Protein Accession#
AAH00759.1Gene Name
NXT1
Gene Alias
MTR2, P15
Gene Description
NTF2-like export factor 1
Omim ID
605811Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is located in the nuclear envelope. It has protein similarity to nuclear transport factor 2. This protein functions as a nuclear export factor in both RAN (Ras-related nuclear protein)- and CRM1 (required for chromosome region maintenance)-dependent pathways. It is found to stimulate the export of U1 snRNA in RAN- and CRM1-dependent pathways and the export of tRNA and mRNA in a CRM1-independent pathway. The encoded protein heterodimerizes with Tap protein and may regulate the ability of Tap protein to mediate nuclear mRNA export. The use of alternate polyadenylation sites has been found for this gene. [provided by RefSeq
Other Designations
NTX2-like export factor1|NUTF-like export factor 1|OTTHUMP00000030420
-
Interactome
-
Publication Reference
-
NXT1, a Novel Influenza A NP Binding Protein, Promotes the Nuclear Export of NP via a CRM1-Dependent Pathway.
Chutiwitoonchai N,Aida Y.
Viruses 2016 Jul; 8(8):E209.
Application：WB-Tr, Human, Dog, HeLa, A549, MDCK cells.
-
NXT1, a Novel Influenza A NP Binding Protein, Promotes the Nuclear Export of NP via a CRM1-Dependent Pathway.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com