NXT1 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot detection against Immunogen (41.51 KDa) .
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length recombinant NXT1.
Immunogen
NXT1 (AAH00759, 1 a.a. ~ 140 a.a) full-length recombinant protein with GST tag.
Sequence
MASVDFKTYVDQACRAAEEFVNVYYTTMDKRRRLLSRLYMGTATLVWNGNAVSGQESSSEFFEMLPSSEFQISVVDCQPVHDEATPSQTTVLVVICGSVKFEGNKQRDFNQNFILTAQASPSNTVWKIASDCFRFQDWAS
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (97); Rat (97)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (41.51 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
ELISA
-
Gene Info — NXT1
Entrez GeneID
29107GeneBank Accession#
BC000759Protein Accession#
AAH00759Gene Name
NXT1
Gene Alias
MTR2, P15
Gene Description
NTF2-like export factor 1
Omim ID
605811Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is located in the nuclear envelope. It has protein similarity to nuclear transport factor 2. This protein functions as a nuclear export factor in both RAN (Ras-related nuclear protein)- and CRM1 (required for chromosome region maintenance)-dependent pathways. It is found to stimulate the export of U1 snRNA in RAN- and CRM1-dependent pathways and the export of tRNA and mRNA in a CRM1-independent pathway. The encoded protein heterodimerizes with Tap protein and may regulate the ability of Tap protein to mediate nuclear mRNA export. The use of alternate polyadenylation sites has been found for this gene. [provided by RefSeq
Other Designations
NTX2-like export factor1|NUTF-like export factor 1|OTTHUMP00000030420
-
Interactome
-
Publication Reference
-
Influenza virus targets the mRNA export machinery and the nuclear pore complex.
Satterly N, Tsai PL, van Deursen J, Nussenzveig DR, Wang Y, Faria PA, Levay A, Levy DE, Fontoura BM.
PNAS 2007 Jan; 104(6):1853.
Application：WB, Human, HEK 293T cells.
-
Influenza virus targets the mRNA export machinery and the nuclear pore complex.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com