HEMK2 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
HEMK2 MaxPab polyclonal antibody. Western Blot analysis of HEMK2 expression in human spleen.
Western Blot (Transfected lysate)
Western Blot analysis of N6AMT1 expression in transfected 293T cell line (H00029104-T01) by N6AMT1 MaxPab polyclonal antibody.
Lane 1: HEMK2 transfected lysate(20.46 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human HEMK2 protein.
Immunogen
HEMK2 (AAH11554.1, 1 a.a. ~ 186 a.a) full-length human protein.
Sequence
MAGENFATPFHGHVGRGAFSDVYEPAEDTFLLLDALEAAAAELAGVEICLEVGSGSGVVSAFLASMIGPQALYMCTDINPEAAACTLETARCNKVHIQPVITDLVGSHGIEAAWAGGRNGREVMDRFFPLVPDLLSPRGLFYLVTIKENNPEEILKIMKTKGLQGTTALSRQAGQETLSVLKFTKS
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (76); Rat (77)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
HEMK2 MaxPab polyclonal antibody. Western Blot analysis of HEMK2 expression in human spleen.Western Blot (Transfected lysate)
Western Blot analysis of N6AMT1 expression in transfected 293T cell line (H00029104-T01) by N6AMT1 MaxPab polyclonal antibody.
Lane 1: HEMK2 transfected lysate(20.46 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — N6AMT1
Entrez GeneID
29104GeneBank Accession#
BC011554.1Protein Accession#
AAH11554.1Gene Name
N6AMT1
Gene Alias
C21orf127, HEMK2, MGC19995, MTQ2, N6AMT, PRED28
Gene Description
N-6 adenine-specific DNA methyltransferase 1 (putative)
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene belongs to the methyltransferase superfamily. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified. [provided by RefSeq
Other Designations
HemK methyltransferase family member 2|N-6 adenine-specific DNA methyltransferase 1|N6-DNA-methyltransferase|OTTHUMP00000096393|OTTHUMP00000096394
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com