Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

HEMK2 purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00029104-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human HEMK2 protein.
  • Immunogen:
  • HEMK2 (AAH11554.1, 1 a.a. ~ 186 a.a) full-length human protein.
  • Sequence:
  • MAGENFATPFHGHVGRGAFSDVYEPAEDTFLLLDALEAAAAELAGVEICLEVGSGSGVVSAFLASMIGPQALYMCTDINPEAAACTLETARCNKVHIQPVITDLVGSHGIEAAWAGGRNGREVMDRFFPLVPDLLSPRGLFYLVTIKENNPEEILKIMKTKGLQGTTALSRQAGQETLSVLKFTKS
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • HEMK2 MaxPab polyclonal antibody. Western Blot analysis of HEMK2 expression in human spleen.
  • PDF DownloadProtocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of N6AMT1 expression in transfected 293T cell line (H00029104-T01) by N6AMT1 MaxPab polyclonal antibody.

    Lane 1: HEMK2 transfected lysate(20.46 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • N6AMT1
  • Gene Alias:
  • C21orf127,HEMK2,MGC19995,MTQ2,N6AMT,PRED28
  • Gene Description:
  • N-6 adenine-specific DNA methyltransferase 1 (putative)
  • Gene Summary:
  • The protein encoded by this gene belongs to the methyltransferase superfamily. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified. [provided by RefSeq
  • Other Designations:
  • HemK methyltransferase family member 2,N-6 adenine-specific DNA methyltransferase 1,N6-DNA-methyltransferase,OTTHUMP00000096393,OTTHUMP00000096394
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook