Product Browser

Last updated: 2022/6/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

RNASEN (Human) Recombinant Protein (Q01) 

  • Catalog # : H00029102-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human RNASEN partial ORF ( NP_037367.2, 1099 a.a. - 1196 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • ETSPVLQKLTEFEEAIGVIFTHVRLLARAFTLRTVGFNHLTLGHNQRMEFLGDSIMQLVATEYLFIHFPDHHEGHLTLLRSSLVNNRTQAKVAEELGM
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.52
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00029102-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Interspecies Antigen Sequence:
  • Mouse (100); Rat (100)
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • RNASEN
  • Gene Alias:
  • DROSHA,ETOHI2,HSA242976,RANSE3L,RN3,RNASE3L
  • Gene Description:
  • ribonuclease type III, nuclear
  • Gene Summary:
  • Members of the ribonuclease III superfamily of double-stranded (ds) RNA-specific endoribonucleases participate in diverse RNA maturation and decay pathways in eukaryotic and prokaryotic cells (Fortin et al., 2002 [PubMed 12191433]). The RNase III Drosha is the core nuclease that executes the initiation step of microRNA (miRNA) processing in the nucleus (Lee et al., 2003 [PubMed 14508493]).[supplied by OMIM
  • Other Designations:
  • drosha, double-stranded RNA-specific endoribonuclease,drosha, ribonuclease type III,nuclear RNase III Drosha,putative protein p241 which interacts with transcription factor Sp1,putative ribonuclease III,ribonuclease III, nuclear
  • RSS
  • YouTube
  • Linkedin
  • Facebook