UBE2T monoclonal antibody (M03), clone 2A12-4F11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of UBE2T expression in transfected 293T cell line by UBE2T monoclonal antibody (M03), clone 2A12-4F11.
Lane 1: UBE2T transfected lysate(22.5 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of UBE2T transfected lysate using anti-UBE2T monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with UBE2T MaxPab rabbit polyclonal antibody.
Western Blot detection against Immunogen (47.41 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant UBE2T.
Immunogen
UBE2T (AAH04152, 1 a.a. ~ 197 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MQRASRLKRELHMLATEPPPGITCWQDKDQMDDLRAQILGGANTPYEKGVFKLEVIIPERYPFEPPQIRFLTPIYHPNIDSAGRICLDVLKLPPKGAWRPSLNIATVLTSIQLLMSEPNPDDPLMADISSEFKYNKPAFLKNARQWTEKHARQKQKADEEEMLDNLPEAGDSRVHNSTQKRKASQLVGIEKKFHPDV
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (85); Rat (82)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (47.41 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of UBE2T expression in transfected 293T cell line by UBE2T monoclonal antibody (M03), clone 2A12-4F11.
Lane 1: UBE2T transfected lysate(22.5 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunoprecipitation
Immunoprecipitation of UBE2T transfected lysate using anti-UBE2T monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with UBE2T MaxPab rabbit polyclonal antibody.ELISA
-
Gene Info — UBE2T
Entrez GeneID
29089GeneBank Accession#
BC004152Protein Accession#
AAH04152Gene Name
UBE2T
Gene Alias
HSPC150, PIG50
Gene Description
ubiquitin-conjugating enzyme E2T (putative)
Omim ID
610538Gene Ontology
HyperlinkGene Summary
The covalent conjugation of ubiquitin to proteins regulates diverse cellular pathways and proteins. Ubiquitin is transferred to a target protein through a concerted action of a ubiquitin-activating enzyme (E1), a ubiquitin-conjugating enzyme (E2), such as UBE2T, and a ubiquitin ligase (E3) (Machida et al., 2006 [PubMed 16916645]).[supplied by OMIM
Other Designations
HSPC150 protein similar to ubiquitin-conjugating enzyme|OTTHUMP00000038808|ubiquitin conjugating enzyme
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com