Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CHMP4A (Human) Recombinant Protein (P01)

  • Catalog # : H00029082-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CHMP4A full-length ORF ( ADR82892.1, 1 a.a. - 265 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MSRRRPEDGLGKAGPCVMRHHPPRSKAEVWRTLRGGGGRGELAMSGLGRLFGKGKKEKGPTPEEAIQKLKETEKILIKKQEFLEQKIQQELQTAKKYGTKNKRAALQALRRKKRFEQQLAQTDGTLSTLEFQREAIENATTNAEVLRTMELAAQSMKKAYQDMDIDKVDELMTDITEQQEVAQQISDAISRPMGFGDDVDEDELLEELEELEQEELAQELLNVGDKEEEPSVKLPSVPSTHLPAGPAPKVDEDEEALKQLAEWVS
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 29.2
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • CHMP4A
  • Gene Alias:
  • C14orf123,CHMP4,CHMP4B,HSPC134,MGC142093,MGC142095,SNF7,SNF7-1,Shax2
  • Gene Description:
  • chromatin modifying protein 4A
  • Gene Summary:
  • CHMP4A belongs to the chromatin-modifying protein/charged multivesicular body protein (CHMP) family. These proteins are components of ESCRT-III (endosomal sorting complex required for transport III), a complex involved in degradation of surface receptor proteins and formation of endocytic multivesicular bodies (MVBs). Some CHMPs have both nuclear and cytoplasmic/vesicular distributions, and one such CHMP, CHMP1A (MIM 164010), is required for both MVB formation and regulation of cell cycle progression (Tsang et al., 2006 [PubMed 16730941]).[supplied by OMIM
  • Other Designations:
  • OTTHUMP00000164695,Snf7 homologue associated with Alix 2,charged multivesicular body protein 4A
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook