Product Browser

Last updated: 2017/3/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ZC3H7A MaxPab mouse polyclonal antibody (B01)MaxPab

  • Catalog # : H00029066-B01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human ZC3H7A protein.
  • Immunogen:
  • ZC3H7A (AAH12575, 1 a.a. ~ 167 a.a) full-length human protein.
  • Sequence:
  • MKENGIQDMEQFYELWLKSQKNEKSEDIASQSNKENGKQIHMPTDYAEVTVDFHCWMCGKNCNSEKQWQGHISSEKHKEKVFHTEDDQYCWQHRFPTGYFSICDRYMNGTCPEGNSCKFAHGNAELHEWEERRDALKMKLNKARKDHLIGPNDNDFGKYSFLFKDLN
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of ZC3H7A expression in transfected 293T cell line (H00029066-T01) by ZC3H7A MaxPab polyclonal antibody.

    Lane 1: ZC3H7A transfected lysate(18.37 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • ZC3H7A
  • Gene Alias:
  • FLJ10027,FLJ20318,HSPC055,ZC3H7,ZC3HDC7
  • Gene Description:
  • zinc finger CCCH-type containing 7A
  • Other Designations:
  • zinc finger CCCH type domain containing 7,zinc finger CCCH-type domain containing 7,zinc-finger protein AY163807
  • RSS
  • YouTube
  • Linkedin
  • Facebook