HIPK2 monoclonal antibody (M06), clone 4E3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
HIPK2 monoclonal antibody (M06), clone 4E3. Western Blot analysis of HIPK2 expression in human ovarian cancer.
Western Blot (Cell lysate)
HIPK2 monoclonal antibody (M06), clone 4E3. Western Blot analysis of HIPK2 expression in RIN-m5F.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged HIPK2 is 0.3 ng/ml as a capture antibody.
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant HIPK2.
Immunogen
HIPK2 (AAG41236.1, 961 a.a. ~ 1065 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
TGNPRTIIVPPLKTQASEVLVECDSLVPVNTSHHSSSYKSKSSSNVTSTSGHSSGSSSGAITYRQQRPGPHFQQQQPLNLSQAQQHITTDRTGSHRRQQAYITPT
Host
Mouse
Reactivity
Human, Rat
Interspecies Antigen Sequence
Mouse (95); Rat (95)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
HIPK2 monoclonal antibody (M06), clone 4E3. Western Blot analysis of HIPK2 expression in human ovarian cancer.Western Blot (Cell lysate)
HIPK2 monoclonal antibody (M06), clone 4E3. Western Blot analysis of HIPK2 expression in RIN-m5F.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged HIPK2 is 0.3 ng/ml as a capture antibody.ELISA
-
Gene Info — HIPK2
Entrez GeneID
28996GeneBank Accession#
AF208291Protein Accession#
AAG41236.1Gene Name
HIPK2
Gene Alias
DKFZp686K02111, FLJ23711, PRO0593
Gene Description
homeodomain interacting protein kinase 2
Omim ID
606868Gene Ontology
HyperlinkGene Summary
HIPK2 is a conserved serine/threonine nuclear kinase that interacts with homeodomain transcription factors.[supplied by OMIM
Other Designations
-
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com