HIPK2 monoclonal antibody (M03), clone 1F10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
HIPK2 monoclonal antibody (M03), clone 1F10 Western Blot analysis of HIPK2 expression in MES-SA/Dx5 ( Cat # L021V1 ).
Western Blot (Cell lysate)
HIPK2 monoclonal antibody (M03), clone 1F10. Western Blot analysis of HIPK2 expression in RIN-m5F.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to HIPK2 on formalin-fixed paraffin-embedded human esophagus. [antibody concentration 1 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged HIPK2 is approximately 0.1ng/ml as a capture antibody.
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant HIPK2.
Immunogen
HIPK2 (AAG41236.1, 961 a.a. ~ 1065 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
TGNPRTIIVPPLKTQASEVLVECDSLVPVNTSHHSSSYKSKSSSNVTSTSGHSSGSSSGAITYRQQRPGPHFQQQQPLNLSQAQQHITTDRTGSHRRQQAYITPT
Host
Mouse
Reactivity
Human, Rat
Interspecies Antigen Sequence
Mouse (95); Rat (95)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
HIPK2 monoclonal antibody (M03), clone 1F10 Western Blot analysis of HIPK2 expression in MES-SA/Dx5 ( Cat # L021V1 ).Western Blot (Cell lysate)
HIPK2 monoclonal antibody (M03), clone 1F10. Western Blot analysis of HIPK2 expression in RIN-m5F.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to HIPK2 on formalin-fixed paraffin-embedded human esophagus. [antibody concentration 1 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged HIPK2 is approximately 0.1ng/ml as a capture antibody.ELISA
-
Gene Info — HIPK2
Entrez GeneID
28996GeneBank Accession#
AF208291Protein Accession#
AAG41236.1Gene Name
HIPK2
Gene Alias
DKFZp686K02111, FLJ23711, PRO0593
Gene Description
homeodomain interacting protein kinase 2
Omim ID
606868Gene Ontology
HyperlinkGene Summary
HIPK2 is a conserved serine/threonine nuclear kinase that interacts with homeodomain transcription factors.[supplied by OMIM
Other Designations
-
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com