RGC32 monoclonal antibody (M01), clone 3B9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged C13orf15 is 0.03 ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to C13orf15 on HeLa cell . [antibody concentration 10 ug/ml]
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant C13orf15.
Immunogen
RGC32 (NP_054778.1, 1 a.a. ~ 117 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MKPPAEDLSDALCEFDAVLADFASPFHERHFHYEEHLERMKRRSSASVSDSSGFSDSESADSLYRNSFSFSDEKLNSPTDSTPALLSATVTPQKAKLGDTKELEAFIADLDKTLASM
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (87); Rat (91)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged C13orf15 is 0.03 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to C13orf15 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — C13orf15
Entrez GeneID
28984GeneBank Accession#
NM_014059Protein Accession#
NP_054778.1Gene Name
C13orf15
Gene Alias
KIAA0564, MGC87338, RGC-32, RGC32, bA157L14.2
Gene Description
chromosome 13 open reading frame 15
Omim ID
610077Gene Ontology
HyperlinkGene Summary
This gene is thought to regulate cell cycle progression. It is induced by p53 in response to DNA damage, or by sublytic levels of complement system proteins that result in activation of the cell cycle. The encoded protein localizes to the cytoplasm during interphase and to centrosomes during mitosis. The protein forms a complex with polo-like kinase 1. The protein also translocates to the nucleus in response to treatment with complement system proteins, and can associate with and increase the kinase activity of cell division cycle 2 protein. In different assays and cell types, overexpression of this protein has been shown to activate or suppress cell cycle progression. [provided by RefSeq
Other Designations
OTTHUMP00000018322|response gene to complement 32
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com