FLVCR monoclonal antibody (M05), clone 4B2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant FLVCR.
Immunogen
FLVCR (NP_054772, 1 a.a. ~ 83 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MARPDDEEGAAVAPGHPLAKGYLPLPRGAPVGKESVELQNGPKAGTFPVNGAPRDSLAAASGVLGGPQTPLAPEEETQARLLP
Host
Mouse
Reactivity
Human
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (34.87 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of FLVCR expression in transfected 293T cell line by FLVCR monoclonal antibody (M05), clone 4B2.
Lane 1: FLVCR transfected lysate(59.9 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged FLVCR1 is 0.3 ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of FLVCR over-expressed 293 cell line, cotransfected with FLVCR Validated Chimera RNAi ( Cat # H00028982-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with FLVCR monoclonal antibody (M05), clone 4B2 (Cat # H00028982-M05 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — FLVCR1
-
Interactome
-
Publication Reference
-
Heme-Oxygenases during Erythropoiesis in K562 and Human Bone Marrow Cells.
Alves LR, Costa ES, Sorgine MH, Nascimento-Silva MC, Teodosio C, Barcena P, Castro-Faria-Neto HC, Bozza PT, Orfao A, Oliveira PL, Maya-Monteiro CM.
PLoS One 2011 Jul; 6(7):e21358.
Application:Flow Cyt, Human, Bone Marrow Cells.
-
Heme-Oxygenases during Erythropoiesis in K562 and Human Bone Marrow Cells.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com