TRIB2 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human TRIB2 full-length ORF ( AAH02637, 1 a.a. - 343 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MNIHRSTPITIARYGRSRNKTQDFEELSSIRSAEPSQSFSPNLGSPSPPETPNLSHCVSCIGKYLLLEPLEGDHVFRAVHLHSGEELVCKVFDISCYQESLAPCFCLSAHSNINQITEIILGETKAYVFFERSYGDMHSFVRTCKKLREEEAARLFYQIASAVAHCHDGGLVLRDLKLRKFIFKDEERTRVKLESLEDAYILRGDDDSLSDKHGCPAYVSPEILNTSGSYSGKAADVWSLGVMLYTMLVGRYPFHDIEPSSLFSKIRRGQFNIPETLSPKAKCLIRSILRREPSERLTSQEILDHPWFSTDFSVSNSAYGAKEVSDQLVPDVNMEENLDPFFN
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
63.47
Interspecies Antigen Sequence
Mouse (98)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — TRIB2
Entrez GeneID
28951GeneBank Accession#
BC002637Protein Accession#
AAH02637Gene Name
TRIB2
Gene Alias
C5FW, GS3955, TRB2
Gene Description
tribbles homolog 2 (Drosophila)
Omim ID
609462Gene Ontology
HyperlinkGene Summary
This gene encodes one of three members of the Tribbles family. The Tribbles members share a Trb domain, which is homologous to protein serine-threonine kinases, but lacks the active site lysine and probably lacks a catalytic function. The Tribbles proteins interact and modulate the activity of signal transduction pathways in a number of physiological and pathological processes. This Tribbles member induces apoptosis of cells mainly of the hematopoietic origin. It has been identified as a protein up-regulated by inflammatory stimuli in myeloid (THP-1) cells, and also as an oncogene that inactivates the transcription factor C/EBPalpha (CCAAT/enhancer-binding protein alpha) and causes acute myelogenous leukemia. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq
Other Designations
tribbles homolog 2
-
Interactome
-
Disease
-
Publication Reference
-
Reciprocal regulation between O-GlcNAcylation and tribbles pseudokinase 2 (TRIB2) maintains transformative phenotypes in liver cancer cells.
Yao B, Xub Y, Wang J,Qiaoe Y, Zhangf Y, Zhang X, Chenc Y, Wu Q, Zhaoc Y, Zhuc G, Sunc F, Li Z, Yuana H.
Cellular Signalling 2016 Nov; 28(11):1703.
Application：Incubated, Recombinant protein.
-
Impaired phosphorylation and ubiquitination by P70 S6 kinase (P70S6K) and Smad ubiquitination regulatory factor 1 (Smurf1) promotes Tribbles homolog 2 (TRIB2) stability and carcinogenic property in liver cancer.
Wang J, Zhang Y, Weng W, Qiao Y, Ma L, Xiao W, Yu Y, Pan Q, Sun F.
The Journal of Biological Chemistry 2013 Nov; 288(47):33667.
Application：IP, Human, Liver cancer.
-
Reciprocal regulation between O-GlcNAcylation and tribbles pseudokinase 2 (TRIB2) maintains transformative phenotypes in liver cancer cells.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com