TRIB2 monoclonal antibody (M11), clone 1D11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Immunoprecipitation
Immunoprecipitation of TRIB2 transfected lysate using anti-TRIB2 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with TRIB2 MaxPab rabbit polyclonal antibody.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TRIB2 is 1 ng/ml as a capture antibody.
Western Blot detection against Immunogen (63.47 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant TRIB2.
Immunogen
TRIB2 (AAH02637, 1 a.a. ~ 343 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MNIHRSTPITIARYGRSRNKTQDFEELSSIRSAEPSQSFSPNLGSPSPPETPNLSHCVSCIGKYLLLEPLEGDHVFRAVHLHSGEELVCKVFDISCYQESLAPCFCLSAHSNINQITEIILGETKAYVFFERSYGDMHSFVRTCKKLREEEAARLFYQIASAVAHCHDGGLVLRDLKLRKFIFKDEERTRVKLESLEDAYILRGDDDSLSDKHGCPAYVSPEILNTSGSYSGKAADVWSLGVMLYTMLVGRYPFHDIEPSSLFSKIRRGQFNIPETLSPKAKCLIRSILRREPSERLTSQEILDHPWFSTDFSVSNSAYGAKEVSDQLVPDVNMEENLDPFFN
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (98)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (63.47 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Immunoprecipitation
Immunoprecipitation of TRIB2 transfected lysate using anti-TRIB2 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with TRIB2 MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TRIB2 is 1 ng/ml as a capture antibody.ELISA
-
Gene Info — TRIB2
Entrez GeneID
28951GeneBank Accession#
BC002637Protein Accession#
AAH02637Gene Name
TRIB2
Gene Alias
C5FW, GS3955, TRB2
Gene Description
tribbles homolog 2 (Drosophila)
Omim ID
609462Gene Ontology
HyperlinkGene Summary
This gene encodes one of three members of the Tribbles family. The Tribbles members share a Trb domain, which is homologous to protein serine-threonine kinases, but lacks the active site lysine and probably lacks a catalytic function. The Tribbles proteins interact and modulate the activity of signal transduction pathways in a number of physiological and pathological processes. This Tribbles member induces apoptosis of cells mainly of the hematopoietic origin. It has been identified as a protein up-regulated by inflammatory stimuli in myeloid (THP-1) cells, and also as an oncogene that inactivates the transcription factor C/EBPalpha (CCAAT/enhancer-binding protein alpha) and causes acute myelogenous leukemia. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq
Other Designations
tribbles homolog 2
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com