TRIB2 monoclonal antibody (M04), clone 1B1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant TRIB2.
Immunogen
TRIB2 (NP_067675, 254 a.a. ~ 343 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
FHDIEPSSLFSKIRRGQFNIPETLSPKAKCLIRSILRREPSERLTSQEILDHPWFSTDFSVSNSAYGAKEVSDQLVPDVNMEENLDPFFN
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (98)
Isotype
IgG2b Lambda
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.64 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of TRIB2 expression in transfected 293T cell line by TRIB2 monoclonal antibody (M04), clone 1B1.
Lane 1: TRIB2 transfected lysate(38.8 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to TRIB2 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TRIB2 is approximately 0.03ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of TRIB2 over-expressed 293 cell line, cotransfected with TRIB2 Validated Chimera RNAi ( Cat # H00028951-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with TRIB2 monoclonal antibody (M04), clone 1B1 (Cat # H00028951-M04 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — TRIB2
Entrez GeneID
28951GeneBank Accession#
NM_021643Protein Accession#
NP_067675Gene Name
TRIB2
Gene Alias
C5FW, GS3955, TRB2
Gene Description
tribbles homolog 2 (Drosophila)
Omim ID
609462Gene Ontology
HyperlinkGene Summary
This gene encodes one of three members of the Tribbles family. The Tribbles members share a Trb domain, which is homologous to protein serine-threonine kinases, but lacks the active site lysine and probably lacks a catalytic function. The Tribbles proteins interact and modulate the activity of signal transduction pathways in a number of physiological and pathological processes. This Tribbles member induces apoptosis of cells mainly of the hematopoietic origin. It has been identified as a protein up-regulated by inflammatory stimuli in myeloid (THP-1) cells, and also as an oncogene that inactivates the transcription factor C/EBPalpha (CCAAT/enhancer-binding protein alpha) and causes acute myelogenous leukemia. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq
Other Designations
tribbles homolog 2
-
Interactome
-
Disease
-
Publication Reference
-
TRIB2 inhibits Wnt/β-Catenin/TCF4 signaling through its associated Ubiquitin E3 ligases, β-TrCP, COP1 and Smurf1, in liver cancer cells.
Xu S, Tong M, Huang J, Zhang Y, Qiao Y, Weng W, Liu W, Wang J, Sun F.
FEBS Letters 2014 Nov; 588(23):4334.
Application:IP-WB, WB-Tr, Human, Bel-7402 cells.
-
Ubiquitin E3 ligase SCF(β-TRCP) regulates TRIB2 stability in liver cancer cells.
Qiao Y, Zhang Y, Wang J.
Biochemical and Biophysical Research Communications 2013 Nov; 441(3):555.
Application:IF, IP-WB, WB-Tr, Human, Bel-7402, SMMC-7721 cells.
-
Impaired phosphorylation and ubiquitination by P70 S6 kinase (P70S6K) and Smad ubiquitination regulatory factor 1 (Smurf1) promotes Tribbles homolog 2 (TRIB2) stability and carcinogenic property in liver cancer.
Wang J, Zhang Y, Weng W, Qiao Y, Ma L, Xiao W, Yu Y, Pan Q, Sun F.
The Journal of Biological Chemistry 2013 Nov; 288(47):33667.
Application:IHC-P, IF, Human, Liver cancer.
-
TRIB2 inhibits Wnt/β-Catenin/TCF4 signaling through its associated Ubiquitin E3 ligases, β-TrCP, COP1 and Smurf1, in liver cancer cells.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com