PPP2R3B monoclonal antibody (M08), clone 2E12
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Immunoprecipitation
Immunoprecipitation of PPP2R3B transfected lysate using anti-PPP2R3B monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with PPP2R3B MaxPab rabbit polyclonal antibody.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PPP2R3B is 0.3 ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to PPP2R3B on HeLa cell . [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (50.49 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant PPP2R3B.
Immunogen
PPP2R3B (AAH11180, 1 a.a. ~ 225 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MIDRIFSGAVTRGRKVQKEGKISYADFVWFLISEEDKKTPTSIEYWFRCMDLDGDGALSMFELEYFYEEQCRRLDSMAIEALPFQDCLCQMLDLVKPRTEGKITLQDLKRCKLANVFFDTFFNIEKYLDHEQKEQISLLRDGDSGGPELSDWEKYAAEEYDILVAEETAGEPWEDGFEAELSPVEQKLSALRSPLAQRPFFEAPSPLGAVDLYEYACGDEDLEPL
Host
Mouse
Reactivity
Human
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (50.49 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Immunoprecipitation
Immunoprecipitation of PPP2R3B transfected lysate using anti-PPP2R3B monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with PPP2R3B MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PPP2R3B is 0.3 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to PPP2R3B on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — PPP2R3B
Entrez GeneID
28227GeneBank Accession#
BC011180Protein Accession#
AAH11180Gene Name
PPP2R3B
Gene Alias
NY-REN-8, PPP2R3L, PPP2R3LY, PR48
Gene Description
protein phosphatase 2 (formerly 2A), regulatory subunit B'', beta
Omim ID
300339Gene Ontology
HyperlinkGene Summary
Protein phosphatase 2 (formerly named type 2A) is one of the four major Ser/Thr phosphatases and is implicated in the negative control of cell growth and division. Protein phosphatase 2 holoenzymes are heterotrimeric proteins composed of a structural subunit A, a catalytic subunit C, and a regulatory subunit B. The regulatory subunit is encoded by a diverse set of genes that have been grouped into the B/PR55, B'/PR61, and B''/PR72 families. These different regulatory subunits confer distinct enzymatic specificities and intracellular localizations to the holozenzyme. The product of this gene belongs to the B'' family. The B'' family has been further divided into subfamilies. The product of this gene belongs to the beta subfamily of regulatory subunit B''. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq
Other Designations
NY-REN-8 antigen|OTTHUMP00000022820|PP2A B'' subunit PR48|PP2A, subunit B, PR48 isoform|protein phosphatase 2, regulatory subunit B'', beta|serine/threonine protein phosphatase 2A, 48kDa regulatory subunit B
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com