PPP2R3B purified MaxPab rabbit polyclonal antibody (D02P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human PPP2R3B protein.
Immunogen
PPP2R3B (AAH11180.1, 1 a.a. ~ 225 a.a) full-length human protein.
Sequence
MIDRIFSGAVTRGRKVQKEGKISYADFVWFLISEEDKKTPTSIEYWFRCMDLDGDGALSMFELEYFYEEQCRRLDSMAIEALPFQDCLCQMLDLVKPRTEGKITLQDLKRCKLANVFFDTFFNIEKYLDHEQKEQISLLRDGDSGGPELSDWEKYAAEEYDILVAEETAGEPWEDGFEAELSPVEQKLSALRSPLAQRPFFEAPSPLGAVDLYEYACGDEDLEPL
Host
Rabbit
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
PPP2R3B MaxPab rabbit polyclonal antibody. Western Blot analysis of PPP2R3B expression in human placenta.Western Blot (Transfected lysate)
Western Blot analysis of PPP2R3B expression in transfected 293T cell line (H00028227-T01) by PPP2R3B MaxPab polyclonal antibody.
Lane 1: PPP2R3B transfected lysate(24.86 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — PPP2R3B
Entrez GeneID
28227GeneBank Accession#
BC011180Protein Accession#
AAH11180.1Gene Name
PPP2R3B
Gene Alias
NY-REN-8, PPP2R3L, PPP2R3LY, PR48
Gene Description
protein phosphatase 2 (formerly 2A), regulatory subunit B'', beta
Omim ID
300339Gene Ontology
HyperlinkGene Summary
Protein phosphatase 2 (formerly named type 2A) is one of the four major Ser/Thr phosphatases and is implicated in the negative control of cell growth and division. Protein phosphatase 2 holoenzymes are heterotrimeric proteins composed of a structural subunit A, a catalytic subunit C, and a regulatory subunit B. The regulatory subunit is encoded by a diverse set of genes that have been grouped into the B/PR55, B'/PR61, and B''/PR72 families. These different regulatory subunits confer distinct enzymatic specificities and intracellular localizations to the holozenzyme. The product of this gene belongs to the B'' family. The B'' family has been further divided into subfamilies. The product of this gene belongs to the beta subfamily of regulatory subunit B''. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq
Other Designations
NY-REN-8 antigen|OTTHUMP00000022820|PP2A B'' subunit PR48|PP2A, subunit B, PR48 isoform|protein phosphatase 2, regulatory subunit B'', beta|serine/threonine protein phosphatase 2A, 48kDa regulatory subunit B
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com