MAT2B polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length recombinant MAT2B.
Immunogen
MAT2B (AAH05218, 1 a.a. ~ 323 a.a) full-length recombinant protein with GST tag.
Sequence
MPEMPEDMEQEEVNIPNRRVLVTGATGLLGRAVHKEFQQNNWHAVGCGFRRARPKFEQVNLLDSNAVHHIIHDFQPHVIVHCAAERRPDVVENQPDAASQLNVDASGNLAKEAAAVGAFLIYISSDYVFDGTNPPYREEDIPAPLNLYGKTKLDGEKAVLENNLGAAVLRIPILYGEVEKLEESAVTVMFDKVQFSNKSANMDHWQQRFPTHVKDVATVCRQLAEKRMLDPSIKGTFHWSGNEQMTKYEMACAIADAFNLPSSHLRPITDSPVLGAQRPRNTQLDCSKLETLGIGQRTPFRIGIKESLWPFLIDKRWRQTVFH
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (94); Rat (94)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (61.64 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
ELISA
-
Gene Info — MAT2B
Entrez GeneID
27430GeneBank Accession#
BC005218Protein Accession#
AAH05218Gene Name
MAT2B
Gene Alias
MAT-II, MATIIbeta, MGC12237, Nbla02999, SDR23E1, TGR
Gene Description
methionine adenosyltransferase II, beta
Omim ID
605527Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene belongs to the methionine adenosyltransferase (MAT) family. MAT catalyzes the biosynthesis of S-adenosylmethionine from methionine and ATP. This protein is the regulatory beta subunit of MAT. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified. [provided by RefSeq
Other Designations
beta regulatory subunit of methionine adenosyltransferase|dTDP-4-keto-6-deoxy-D-glucose 4-reductase|putative protein product of Nbla02999|short chain dehydrogenase/reductase family 23E, member 1
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
S-adenosylmethionine stimulates fatty acid metabolism-linked gene expression in porcine muscle satellite cells.
Yue T, Fang Q, Yin J, Li D, Li W.
Molecular Biology Reports 2010 Oct; 37(7):3143.
Application:WB-Ce, Pig, Pig muscle satellite cells.
-
Characterization of methionine adenosyltransferase 2beta gene expression in skeletal muscle and subcutaneous adipose tissue from obese and lean pigs.
Fang Q, Yin J, Li F, Zhang J, Watford M.
Molecular Biology Reports 2010 Jun; 37(5):2517.
Application:WB, Pig, Muscle, liver, adipose, stomach, duodenum.
-
Lentivirus mediated shRNA interference targeting MAT2B induces growth-inhibition and apoptosis in hepatocellular carcinoma.
Wang Q, Liu QY, Liu ZS, Qian Q, Sun Q, Pan DY.
World Journal of Gastroenterology 2008 Aug; 14(29):4633.
Application:WB-Tr, Human, HEK 293T cells.
-
S-adenosylmethionine stimulates fatty acid metabolism-linked gene expression in porcine muscle satellite cells.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com