Product Browser

Last updated: 2017/2/19
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MT monoclonal antibody (M01), clone 2F2

  • Catalog # : H00027349-M01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant MT.
  • Immunogen:
  • MT (NP_775738, 291 a.a. ~ 390 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • KKPLVSVYSNVHAHRYRHPGHIHKLLAQQLVSPVKWEQTMHAIYERKKGRGFPQTFEVGPGRQLGAILKSCNMQAWKSYSAVDVLQTLEHVDLDPQEPPR
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00027349-M01
    Western Blot detection against Immunogen (36.74 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • MT monoclonal antibody (M01), clone 2F2 Western Blot analysis of MT expression in HeLa ( Cat # L013V1 ).
  • PDF DownloadProtocol Download
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) enlargeenlarge this image
  • Immunoperoxidase of monoclonal antibody to MT on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml]
  • PDF DownloadProtocol Download
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Detection limit for recombinant GST tagged MT is approximately 1ng/ml as a capture antibody.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • enlarge
  • ELISA
  • Gene Information
  • Gene Name:
  • MCAT
  • Gene Alias:
  • FASN2C,MCT,MGC47838,MT,fabD
  • Gene Description:
  • malonyl CoA:ACP acyltransferase (mitochondrial)
  • Gene Summary:
  • The protein encoded by this gene is found exclusively in the mitochondrion, where it catalyzes the transfer of a malonyl group from malonyl-CoA to the mitochondrial acyl carrier protein. The encoded protein may be part of a fatty acid synthase complex that is more like the type II prokaryotic and plastid complexes rather than the type I human cytosolic complex. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • malonyl-CoA:acyl carrier protein transacylase, mitochondrial,mitochondrial malonyltransferase
  • RSS
  • YouTube
  • Linkedin
  • Facebook