Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

  • By Antibody/Protein

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MCAT MaxPab rabbit polyclonal antibody (D01)MaxPab

  • Catalog # : H00027349-D01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human MCAT protein.
  • Immunogen:
  • MCAT (NP_055322.1, 1 a.a. ~ 180 a.a) full-length human protein.
  • Sequence:
  • MSVRVARVAWVRGLGASYRRGASSFPVPPPGAQGVAELLRDATGAEEEAPWAATERRMPGQCSVLLFPGQGSQVVGMGRGLLNYPRVRELYAAARRVLGYDLLELSLHGPQETLDRTVHCQPAIFVASLAAVEKLHHLQPSVIENCVAAAGFSVGEFAALVFAGAMEFAEGSTVSPEEFL
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of MCAT expression in transfected 293T cell line (H00027349-T02) by MCAT MaxPab polyclonal antibody.

    Lane 1: MCAT transfected lysate(19.2 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Immunoprecipitation
  • Immunoprecipitation
  • Immunoprecipitation of MCAT transfected lysate using anti-MCAT MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with MCAT MaxPab mouse polyclonal antibody (B01) (H00027349-B01).
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • MCAT
  • Gene Alias:
  • FASN2C,MCT,MGC47838,MT,fabD
  • Gene Description:
  • malonyl CoA:ACP acyltransferase (mitochondrial)
  • Gene Summary:
  • The protein encoded by this gene is found exclusively in the mitochondrion, where it catalyzes the transfer of a malonyl group from malonyl-CoA to the mitochondrial acyl carrier protein. The encoded protein may be part of a fatty acid synthase complex that is more like the type II prokaryotic and plastid complexes rather than the type I human cytosolic complex. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • malonyl-CoA:acyl carrier protein transacylase, mitochondrial,mitochondrial malonyltransferase
  • RSS
  • YouTube
  • Linkedin
  • Facebook