Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

DRIM polyclonal antibody (A01)

  • Catalog # : H00027340-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant DRIM.
  • Immunogen:
  • DRIM (NP_055318, 946 a.a. ~ 1053 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • LHQDQMVQKITLDCIMTYKHPHVLPYRENLQRLLEDRSFKEEIVHFSISEDNAVVKTAHRADLFPILMRILYGRMKNKTGSKTQGKSASGTRMAIVLRFLAGTQPEEI
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • ELISA
  • Gene Information
  • Gene Name:
  • UTP20
  • Gene Alias:
  • DRIM
  • Gene Description:
  • UTP20, small subunit (SSU) processome component, homolog (yeast)
  • Gene Summary:
  • UTP20 is a component of the U3 small nucleolar RNA (snoRNA) (SNORD3A; MIM 180710) protein complex (U3 snoRNP) and is involved in 18S rRNA processing (Wang et al., 2007 [PubMed 17498821]).[supplied by OMIM
  • Other Designations:
  • down regulated in metastasis,down-regulated in metastasis
  • RSS
  • YouTube
  • Linkedin
  • Facebook