Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PRPF19 polyclonal antibody (A01)

  • Catalog # : H00027339-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant PRPF19.
  • Immunogen:
  • PRPF19 (NP_055317, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • MSLICSISNEVPEHPCVSPVSNHVYERRLIEKYIAENGTDPINNQPLSEEQLIDIKVAHPIRPKPPSATSIPAILKALQDEWDAVMLHSF
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00027339-A01
    Western Blot detection against Immunogen (36.01 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • PRPF19 polyclonal antibody (A01), Lot # 051121JC01 Western Blot analysis of PRPF19 expression in HeLa ( Cat # L013V1 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • PRPF19
  • Gene Alias:
  • NMP200,PRP19,PSO4,SNEV,UBOX4,hPSO4
  • Gene Description:
  • PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae)
  • Gene Summary:
  • PSO4 is the human homolog of yeast Pso4, a gene essential for cell survival and DNA repair (Beck et al., 2008 [PubMed 18263876]).[supplied by OMIM
  • Other Designations:
  • PRP19/PSO4 homolog,PRP19/PSO4 pre-mRNA processing factor 19 homolog,nuclear matrix protein NMP200 related to splicing factor PRP19
  • RSS
  • YouTube
  • Linkedin
  • Facebook