Product Browser

Last updated: 2016/11/27
  • Related Product Showcase
  • By Research Area

  • By Antibody/Protein

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

UBE2S MaxPab rabbit polyclonal antibody (D01)MaxPab

  • Catalog # : H00027338-D01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human UBE2S protein.
  • Immunogen:
  • UBE2S (NP_055316.2, 1 a.a. ~ 222 a.a) full-length human protein.
  • Sequence:
  • MNSNVENLPPHIIRLVYKEVTTLTADPPDGIKVFPNEEDLTDLQVTIEGPEGTPYAGGLFRMKLLLGKDFPASPPKGYFLTKIFHPNVGANGEICVNVLKRDWTAELGIRHVLLTIKCLLIHPNPESALNEEAGRLLLENYEEYAARARLLTEIHGGAGGPSGRAEAGRALASGTEASSTDPGAPGGPGGAEGPMAKKHAGERDKKLAAKKKTDKKRALRRL
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Immunoprecipitation
  • Immunoprecipitation
  • Immunoprecipitation of UBE2S transfected lysate using anti-UBE2S MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with UBE2S purified MaxPab mouse polyclonal antibody (B01P) (H00027338-B01P).
  • PDF DownloadProtocol Download
  • Application Image
  • Gene Information
  • Gene Name:
  • UBE2S
  • Gene Alias:
  • E2-EPF,E2EPF,EPF5
  • Gene Description:
  • ubiquitin-conjugating enzyme E2S
  • Gene Summary:
  • This gene encodes a member of the ubiquitin-conjugating enzyme family. The encoded protein is able to form a thiol ester linkage with ubiquitin in a ubiquitin activating enzyme-dependent manner, a characteristic property of ubiquitin carrier proteins. [provided by RefSeq
  • Other Designations:
  • ubiquitin carrier protein S,ubiquitin-conjugating enzyme E2-24 kD,ubiquitin-protein ligase S
  • RSS
  • YouTube
  • Linkedin
  • Facebook