Product Browser

Last updated: 2017/5/21

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

EIF3S12 (Human) Recombinant Protein (P01)

  • Catalog # : H00027335-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human EIF3S12 full-length ORF ( NP_037366.1, 1 a.a. - 218 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MAMFEQMRANVGKLLKGIDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNPAFFQTTVTAQILLKALTNLPHTDFTLCKCMIDQAHQEERPIRQILYLGDLLETCHFQAFWQALDENMDLLEGITGFEDSVRKFICHVVGITYQHIDRWLQAEMLGDLSDSQLKVWMSKYGWSADESGQIFICSQEESIKPKNIVEKIDFDSVSSIMASSQ
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 51.5
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00027335-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • EIF3K
  • Gene Alias:
  • ARG134,EIF3-p28,EIF3S12,HSPC029,M9,MSTP001,PLAC-24,PLAC24,PRO1474,PTD001
  • Gene Description:
  • eukaryotic translation initiation factor 3, subunit K
  • Gene Summary:
  • The 700-kD eukaryotic translation initiation factor-3 (eIF3) is the largest eIF and contains at least 12 subunits, including EIF2S12. eIF3 plays an essential role in translation by binding directly to the 40S ribosomal subunit and promoting formation of the 40S preinitiation complex (Mayeur et al., 2003 [PubMed 14519125]).[supplied by OMIM
  • Other Designations:
  • eukaryotic translation initiation factor 3, subunit 12,muscle specific
  • RSS
  • YouTube
  • Linkedin
  • Facebook