Product Browser

Last updated: 2017/11/19

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

EIF3K mouse monoclonal antibody (hybridoma)

  • Catalog # : H00027335-M
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a full-length recombinant EIF3K.
  • Immunogen:
  • EIF3K (NP_037366.1, 1 a.a. ~ 218 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • MAMFEQMRANVGKLLKGIDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNPAFFQTTVTAQILLKALTNLPHTDFTLCKCMIDQAHQEERPIRQILYLGDLLETCHFQAFWQALDENMDLLEGITGFEDSVRKFICHVVGITYQHIDRWLQAEMLGDLSDSQLKVWMSKYGWSADESGQIFICSQEESIKPKNIVEKIDFDSVSSIMASSQ
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactivity and specificity confirmed by ELISA and Western Blot.
  • Note:
  • Customer should check the viability of the hybridomas within one month from the date of receipt. Fee-for-service of long term hybridoma storage can be performed upon customer's request.
  • Deliverables:
  • Up to 5 positive hybridoma clones will be delivered to customer in the cryotube format.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • EIF3K
  • Gene Alias:
  • ARG134,EIF3-p28,EIF3S12,HSPC029,M9,MSTP001,PLAC-24,PLAC24,PRO1474,PTD001
  • Gene Description:
  • eukaryotic translation initiation factor 3, subunit K
  • Gene Summary:
  • The 700-kD eukaryotic translation initiation factor-3 (eIF3) is the largest eIF and contains at least 12 subunits, including EIF2S12. eIF3 plays an essential role in translation by binding directly to the 40S ribosomal subunit and promoting formation of the 40S preinitiation complex (Mayeur et al., 2003 [PubMed 14519125]).[supplied by OMIM
  • Other Designations:
  • eukaryotic translation initiation factor 3, subunit 12,muscle specific
  • RSS
  • YouTube
  • Linkedin
  • Facebook