MOCS3 MaxPab rabbit polyclonal antibody (D01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of MOCS3 expression in transfected 293T cell line (H00027304-T02) by MOCS3 MaxPab polyclonal antibody.
Lane 1: MOCS3 transfected lysate(49.70 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of MOCS3 transfected lysate using anti-MOCS3 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with MOCS3 purified MaxPab mouse polyclonal antibody (B01P) (H00027304-B01P).
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human MOCS3 protein.
Immunogen
MOCS3 (NP_055299.1, 1 a.a. ~ 460 a.a) full-length human protein.
Sequence
MASREEVLALQAEVAQREEELNSLKQKLASALLAEQEPQPERLVPVSPLPPKAALSRDEILRYSRQLVLPELGVHGQLRLGTACVLIVGCGGLGCPLAQYLAAAGVGRLGLVDYDVVEMSNLARQVLHGEALAGQAKAFSAAASLRRLNSAVECVPYTQALTPATALDLVRRYDVVADCSDNVPTRYLVNDACVLAGRPLVSASALRFEGQITVYHYDGGPCYRCIFPQPPPAETVTNCADGGVLGVVTGVLGCLQALEVLKIAAGLGPSYSGSLLLFDALRGHFRSIRLRSRRLDCAACGERPTVTDLLDYEAFCGSSATDKCRSLQLLSPEERVSVTDYKRLLDSGAFHLLLDVRPQVEVDICRLPHALHIPLKHLERRDAESLKLLKEAIWEEKQGTQEGAAVPIYVICKLGNDSQKAVKILQSLSAAQELDPLTVRDVVGGLMAWAAKIDGTFPQY
Host
Rabbit
Reactivity
Human
Interspecies Antigen Sequence
Mouse (79); Rat (80)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
No additive
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of MOCS3 expression in transfected 293T cell line (H00027304-T02) by MOCS3 MaxPab polyclonal antibody.
Lane 1: MOCS3 transfected lysate(49.70 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of MOCS3 transfected lysate using anti-MOCS3 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with MOCS3 purified MaxPab mouse polyclonal antibody (B01P) (H00027304-B01P). -
Gene Info — MOCS3
Entrez GeneID
27304GeneBank Accession#
NM_014484Protein Accession#
NP_055299.1Gene Name
MOCS3
Gene Alias
MGC9252, UBA4, dJ914P20.3
Gene Description
molybdenum cofactor synthesis 3
Omim ID
609277Gene Ontology
HyperlinkGene Summary
Molybdenum cofactor (MoCo) is necessary for the function of all molybdoenzymes. One of the enzymes required for the biosynthesis of MoCo is molybdopterin synthase (MPT synthase). The protein encoded by this gene adenylates and activates MPT synthase. This gene contains no introns. A pseudogene of this gene is present on chromosome 14. [provided by RefSeq
Other Designations
MPT synthase sulfurylase|UBA4, ubiquitin-activating enzyme E1 homolog|molybdopterin synthase sulfurylase|ubiquitin-like modifier activating enzyme 4
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com