Product Browser

Last updated: 2017/5/21
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

RND1 purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00027289-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human RND1 protein.
  • Immunogen:
  • RND1 (NP_055285, 1 a.a. ~ 232 a.a) full-length human protein.
  • Sequence:
  • MKERRAPQPVVARCKLVLVGDVQCGKTAMLQVLAKDCYPETYVPTVFENYTACLETEEQRVELSLWDTSGSPYYDNVRPLCYSDSDAVLLCFDISRPETVDSALKKWRTEILDYCPSTRVLLIGCKTDLRTDLSTLMELSHQKQAPISYEQGCAIAKQLGAEIYLEGSAFTSEKSIHSIFRTASMLCLNKPSPLPQKSPVRSLSKRLLHLPSRSELISSTFKKEKAKSCSIM
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of RND1 expression in transfected 293T cell line (H00027289-T01) by RND1 MaxPab polyclonal antibody.

    Lane1:RND1 transfected lysate(25.52 KDa).
    Lane2:Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • RND1
  • Gene Alias:
  • ARHS,FLJ42294,RHO6,RHOS
  • Gene Description:
  • Rho family GTPase 1
  • Gene Summary:
  • Members of the Rho GTPase family, such as RND1, regulate the organization of the actin cytoskeleton in response to extracellular growth factors (Nobes et al., 1998 [PubMed 9531558]).[supplied by OMIM
  • Other Designations:
  • GTP-binding protein,GTP-binding protein RHO6,ras homolog gene family, member S
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook