Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

RND1 polyclonal antibody (A01)

  • Catalog # : H00027289-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant RND1.
  • Immunogen:
  • RND1 (NP_055285, 133 a.a. ~ 232 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • LSTLMELSHQKQAPISYEQGCAIAKQLGAEIYLEGSAFTSEKSIHSIFRTASMLCLNKPSPLPQKSPVRSLSKRLLHLPSRSELISSTFKKEKAKSCSIM
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • ELISA
  • Gene Information
  • Gene Name:
  • RND1
  • Gene Alias:
  • ARHS,FLJ42294,RHO6,RHOS
  • Gene Description:
  • Rho family GTPase 1
  • Gene Summary:
  • Members of the Rho GTPase family, such as RND1, regulate the organization of the actin cytoskeleton in response to extracellular growth factors (Nobes et al., 1998 [PubMed 9531558]).[supplied by OMIM
  • Other Designations:
  • GTP-binding protein,GTP-binding protein RHO6,ras homolog gene family, member S
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook