TEKT2 monoclonal antibody (M02), clone 2H4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
TEKT2 monoclonal antibody (M02), clone 2H4. Western Blot analysis of TEKT2 expression in human colon.
Western Blot (Cell lysate)
TEKT2 monoclonal antibody (M02), clone 2H4. Western Blot analysis of TEKT2 expression in HeLa.
Western Blot detection against Immunogen (36.63 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant TEKT2.
Immunogen
TEKT2 (NP_055281, 1 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MATLSVKPSRRFQLPDWHTNSYLLSTNAQLQRDASHQIRQEARVLRNETNNQTIWDEHDNRTRLVERIDTVNRWKEMLDKCLTDLDAEIDALTQMKESA
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (83); Rat (84)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
TEKT2 monoclonal antibody (M02), clone 2H4. Western Blot analysis of TEKT2 expression in human colon.Western Blot (Cell lysate)
TEKT2 monoclonal antibody (M02), clone 2H4. Western Blot analysis of TEKT2 expression in HeLa.Western Blot (Recombinant protein)
ELISA
-
Gene Info — TEKT2
Entrez GeneID
27285GeneBank Accession#
NM_014466Protein Accession#
NP_055281Gene Name
TEKT2
Gene Alias
TEKTB1, TEKTIN-T, h-tektin-t
Gene Description
tektin 2 (testicular)
Omim ID
608953Gene Ontology
HyperlinkGene Summary
This gene product belongs to the tektin family of proteins. Tektins comprise a family of filament-forming proteins that are coassembled with tubulins to form ciliary and flagellar microtubules. This gene is expressed in the testis and its protein is localized to the flagella of the sperms, indicating that it may play a role in spermatogenesis. [provided by RefSeq
Other Designations
tektin 2|testicular tektin B1-like protein
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com