SULT1B1 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human SULT1B1 protein.
Immunogen
SULT1B1 (NP_055280.2, 1 a.a. ~ 296 a.a) full-length human protein.
Sequence
MLSPKDILRKDLKLVHGYPMTCAFASNWEKIEQFHSRPDDIVIATYPKSGTTWVSEIIDMILNDGDIEKCKRGFITEKVPMLEMTLPGLRTSGIEQLEKNPSPRIVKTHLPTDLLPKSFWENNCKMIYLARNAKDVSVSYYHFDLMNNLQPFPGTWEEYLEKFLTGKVAYGSWFTHVKNWWKKKEEHPILFLYYEDMKENPKEEIKKIIRFLEKNLNDEILDRIIHHTSFEVMKDNPLVNYTHLPTTVMDHSKSPFMRKGTAGDWKNYFTVAQNEKFDAIYETEMSKTALQFRTEI
Host
Rabbit
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (72); Rat (73)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
SULT1B1 MaxPab rabbit polyclonal antibody. Western Blot analysis of SULT1B1 expression in mouse kidney.Western Blot (Tissue lysate)
SULT1B1 MaxPab rabbit polyclonal antibody. Western Blot analysis of SULT1B1 expression in rat brain.Western Blot (Tissue lysate)
SULT1B1 MaxPab rabbit polyclonal antibody. Western Blot analysis of SULT1B1 expression in human colon.Western Blot (Cell lysate)
SULT1B1 MaxPab rabbit polyclonal antibody. Western Blot analysis of SULT1B1 expression in Hela S3 NE.Western Blot (Transfected lysate)
Western Blot analysis of SULT1B1 expression in transfected 293T cell line (H00027284-T03) by SULT1B1 MaxPab polyclonal antibody.
Lane 1: SULT1B1 transfected lysate(34.90 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — SULT1B1
Entrez GeneID
27284GeneBank Accession#
NM_014465.2Protein Accession#
NP_055280.2Gene Name
SULT1B1
Gene Alias
MGC13356, ST1B2, SULT1B2
Gene Description
sulfotransferase family, cytosolic, 1B, member 1
Omim ID
608436Gene Ontology
HyperlinkGene Summary
Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. However, the total genomic length of this gene is greater than that of other SULT1 genes. [provided by RefSeq
Other Designations
sulfotransferase 1B1|sulfotransferase 1B2|thyroid hormone sulfotransferase
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com