Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

IL1F8 (Human) Recombinant Protein (P01)

  • Catalog # : H00027177-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human IL1F8 full-length ORF ( NP_775270.1, 1 a.a. - 157 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MNPQREAAPKSYAIRDSRQMVWVLSGNSLIAAPLSRSIKPVTLHLIACRDTEFSDKEKGNMVYLGIKGKDLCLFCAEIQGKPTLQLKEKNIMDLYVEKKAQKPFLFFHNKEGSTSVFQSVSYPGWFIATSTTSGQPIFLTKERGITNNTNFYLDSVE
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 44.1
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00027177-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • IL1F8
  • Gene Alias:
  • FIL1,FIL1-(ETA),FIL1H,IL-1F8,IL-1H2,IL1-ETA,IL1H2,MGC126880,MGC126882
  • Gene Description:
  • interleukin 1 family, member 8 (eta)
  • Gene Summary:
  • The protein encoded by this gene is a member of the interleukin 1 cytokine family. Protein structure modeling indicated that this cytokine may contain a 12-stranded beta-trefoil structure that is conserved between IL1A (IL-A alpha) and IL1B (IL-1 beta). This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. Two alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq
  • Other Designations:
  • IL-1F8 (FIL1-eta),IL1F8 (Canonical product IL-1F8a),Interleukin-1 Superfamily e,family of interleukin 1-eta,interleukin 1 family, member 8,interleukin 1, eta,interleukin-1 homolog 2
  • RSS
  • YouTube
  • Linkedin
  • Facebook