IL1F8 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human IL1F8 full-length ORF ( NP_775270.1, 1 a.a. - 157 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MNPQREAAPKSYAIRDSRQMVWVLSGNSLIAAPLSRSIKPVTLHLIACRDTEFSDKEKGNMVYLGIKGKDLCLFCAEIQGKPTLQLKEKNIMDLYVEKKAQKPFLFFHNKEGSTSVFQSVSYPGWFIATSTTSGQPIFLTKERGITNNTNFYLDSVE
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
44.1
Interspecies Antigen Sequence
Mouse (64); Rat (75)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — IL1F8
Entrez GeneID
27177GeneBank Accession#
NM_173178.1Protein Accession#
NP_775270.1Gene Name
IL1F8
Gene Alias
FIL1, FIL1-(ETA), FIL1H, IL-1F8, IL-1H2, IL1-ETA, IL1H2, MGC126880, MGC126882
Gene Description
interleukin 1 family, member 8 (eta)
Omim ID
605508Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the interleukin 1 cytokine family. Protein structure modeling indicated that this cytokine may contain a 12-stranded beta-trefoil structure that is conserved between IL1A (IL-A alpha) and IL1B (IL-1 beta). This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. Two alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq
Other Designations
IL-1F8 (FIL1-eta)|IL1F8 (Canonical product IL-1F8a)|Interleukin-1 Superfamily e|family of interleukin 1-eta|interleukin 1 family, member 8|interleukin 1, eta|interleukin-1 homolog 2
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com