IL1F8 monoclonal antibody (M01), clone 1E4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of IL1F8 expression in transfected 293T cell line by IL1F8 monoclonal antibody (M01), clone 1E4.
Lane 1: IL1F8 transfected lysate(17.7 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged IL1F8 is 0.1 ng/ml as a capture antibody.
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant IL1F8.
Immunogen
IL1F8 (NP_775270.1, 1 a.a. ~ 157 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MNPQREAAPKSYAIRDSRQMVWVLSGNSLIAAPLSRSIKPVTLHLIACRDTEFSDKEKGNMVYLGIKGKDLCLFCAEIQGKPTLQLKEKNIMDLYVEKKAQKPFLFFHNKEGSTSVFQSVSYPGWFIATSTTSGQPIFLTKERGITNNTNFYLDSVE
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (64); Rat (75)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of IL1F8 expression in transfected 293T cell line by IL1F8 monoclonal antibody (M01), clone 1E4.
Lane 1: IL1F8 transfected lysate(17.7 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged IL1F8 is 0.1 ng/ml as a capture antibody.ELISA
-
Gene Info — IL1F8
Entrez GeneID
27177GeneBank Accession#
NM_173178.1Protein Accession#
NP_775270.1Gene Name
IL1F8
Gene Alias
FIL1, FIL1-(ETA), FIL1H, IL-1F8, IL-1H2, IL1-ETA, IL1H2, MGC126880, MGC126882
Gene Description
interleukin 1 family, member 8 (eta)
Omim ID
605508Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the interleukin 1 cytokine family. Protein structure modeling indicated that this cytokine may contain a 12-stranded beta-trefoil structure that is conserved between IL1A (IL-A alpha) and IL1B (IL-1 beta). This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. Two alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq
Other Designations
IL-1F8 (FIL1-eta)|IL1F8 (Canonical product IL-1F8a)|Interleukin-1 Superfamily e|family of interleukin 1-eta|interleukin 1 family, member 8|interleukin 1, eta|interleukin-1 homolog 2
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com