PRELID1 monoclonal antibody (M01), clone 7B4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant PRELID1.
Immunogen
PRELID1 (NP_037369, 3 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
KYFLGQSVLRSSWDQVFAAFWQRYPNPYSKHVLTEDIVHREVTPDQKLLSRRLLTKTNRMPRWAERLFPANVAHSVYVLEDSIVDPQNQTMTTFTWNI
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (98); Rat (98)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.52 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
PX19 monoclonal antibody (M01), clone 7B4 Western Blot analysis of PX19 expression in HeLa ( Cat # L013V1 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to PX19 on formalin-fixed paraffin-embedded human lung. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PX19 is approximately 3ng/ml as a capture antibody.ELISA
-
Gene Info — PRELID1
Entrez GeneID
27166GeneBank Accession#
NM_013237Protein Accession#
NP_037369Gene Name
PRELID1
Gene Alias
CGI-106, MGC87972, PRELI, PX19
Gene Description
PRELI domain containing 1
Omim ID
605733Gene Ontology
HyperlinkOther Designations
protein of relevant evolutionary and lymphoid interest|px19-like protein
-
Interactome
-
Publication Reference
-
Metabolic control of adult neural stem cell self-renewal by the mitochondrial protease YME1L.
Gulzar A Wani, Hans-Georg Sprenger, Kristiano Ndoci, Srikanth Chandragiri, Richard James Acton, Désirée Schatton, Sandra M V Kochan, Vignesh Sakthivelu, Milica Jevtic, Jens M Seeger, Stefan Müller, Patrick Giavalisco, Elena I Rugarli, Elisa Motori, Thomas Langer, Matteo Bergami.
Cell Reports 2022 Feb; 38(7):110370.
Application:WB-Ti, Mouse, Mouse brain.
-
ROMO1 is a constituent of the human presequence translocase required for YME1L protease import.
Richter F, Dennerlein S, Nikolov M, Jans DC, Naumenko N, Aich A, MacVicar T, Linden A, Jakobs S, Urlaub H, Langer T, Rehling P.
The Journal of Cell Biology 2019 Feb; 218(2):598.
Application:WB, Human, HEK 293 cells.
-
Loss of the mitochondrial i-AAA protease YME1L leads to ocular dysfunction and spinal axonopathy.
Sprenger HG, Wani G, Hesseling A, König T, Patron M, MacVicar T, Ahola S, Wai T, Barth E, Rugarli EI, Bergami M, Langer T.
EMBO Molecular Medicine 2018 Nov; [Epub].
Application:WB-Ti, Mouse, Forebrain, Cerebellar, Spinal cord.
-
Metabolic control of adult neural stem cell self-renewal by the mitochondrial protease YME1L.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com