NDOR1 monoclonal antibody (M01A), clone 3A11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant NDOR1.
Immunogen
NDOR1 (NP_055249, 498 a.a. ~ 595 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
EWQELEKRDCLTLIPAFSREQEQKVYVQHRLRELGSLVWELLDRQGAYFYLAGNAKSMPADVSEALMSIFQEEGGLCSPDAAAYLARLQQTRRFQTET
Host
Mouse
Reactivity
Human, Mouse
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.52 KDa) .
Storage Buffer
In ascites fluid
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
NDOR1 monoclonal antibody (M01A), clone 3A11 Western Blot analysis of NDOR1 expression in HeLa ( Cat # L013V1 ).Western Blot (Cell lysate)
NDOR1 monoclonal antibody (M01A), clone 3A11. Western Blot analysis of NDOR1 expression in NIH/3T3(Cat # L018V1 ).Western Blot (Transfected lysate)
Western Blot analysis of NDOR1 expression in transfected 293T cell line by NDOR1 monoclonal antibody (M01A), clone 3A11.
Lane 1: NDOR1 transfected lysate(66.8 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
ELISA
-
Gene Info — NDOR1
Entrez GeneID
27158GeneBank Accession#
NM_014434Protein Accession#
NP_055249Gene Name
NDOR1
Gene Alias
MGC138148, NR1, bA350O14.9
Gene Description
NADPH dependent diflavin oxidoreductase 1
Omim ID
606073Gene Ontology
HyperlinkGene Summary
This gene encodes an NADPH-dependent diflavin reductase that contains both flavin mononucleotide (FMN) and flavin adenine dinucleotide (FAD) binding domains. The encoded protein is an enzyme that catalyzes the transfers electrons from NADPH through FAD and FMN cofactors to potential redox partners. Alternative splicing results in multiple transcript variants. [provided by RefSeq
Other Designations
NADPH dependent FMN and FAD containing oxidoreductase|NADPH-dependent FMN and FAD containing oxidoreductase|OTTHUMP00000064742
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com