Product Browser

Last updated: 2017/10/15
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

NDOR1 polyclonal antibody (A01)

  • Catalog # : H00027158-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant NDOR1.
  • Immunogen:
  • NDOR1 (NP_055249, 498 a.a. ~ 595 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • EWQELEKRDCLTLIPAFSREQEQKVYVQHRLRELGSLVWELLDRQGAYFYLAGNAKSMPADVSEALMSIFQEEGGLCSPDAAAYLARLQQTRRFQTET
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00027158-A01
    Western Blot detection against Immunogen (36.89 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • NDOR1
  • Gene Alias:
  • MGC138148,NR1,bA350O14.9
  • Gene Description:
  • NADPH dependent diflavin oxidoreductase 1
  • Gene Summary:
  • This gene encodes an NADPH-dependent diflavin reductase that contains both flavin mononucleotide (FMN) and flavin adenine dinucleotide (FAD) binding domains. The encoded protein is an enzyme that catalyzes the transfers electrons from NADPH through FAD and FMN cofactors to potential redox partners. Alternative splicing results in multiple transcript variants. [provided by RefSeq
  • Other Designations:
  • NADPH dependent FMN and FAD containing oxidoreductase,NADPH-dependent FMN and FAD containing oxidoreductase,OTTHUMP00000064742
  • RSS
  • YouTube
  • Linkedin
  • Facebook