TAF5L purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human TAF5L protein.
Immunogen
TAF5L (NP_001020418.1, 1 a.a. ~ 325 a.a) full-length human protein.
Sequence
MKRVRTEQIQMAVSCYLKRRQYVDSDGPLKQGLRLSQTAEEMAANLTVQSESGCANIVSAAPCQAEPQQYEVQFGRLRNFLTDSDSQHSHEVMPLLYPLFVYLHLNLVQNSPKSTVESFYSRFHGMFLQNASQKDVIEQLQTTQTIQDILSNFKLRAFLDNKYVVRLQEDSYNYLIRYLQSDNNTALCKVLTLHIHLDVQPAKRTDYQLYASGSSSRSENNGLEPPDMPSPILQNEAALEVLQESIKRVKDGPPSLTTICFYAFYNTEQLLNTAEISPDSKLLAAGFDNSCIKLWSLRSKKLKSEPHQVDVSRIHLACDILEEEV
Host
Rabbit
Reactivity
Human
Interspecies Antigen Sequence
Mouse (92); Rat (91)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
TAF5L MaxPab rabbit polyclonal antibody. Western Blot analysis of TAF5L expression in HeLa.Western Blot (Transfected lysate)
Western Blot analysis of TAF5L expression in transfected 293T cell line (H00027097-T01) by TAF5L MaxPab polyclonal antibody.
Lane 1: TAF5L transfected lysate(37.00 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — TAF5L
Entrez GeneID
27097GeneBank Accession#
NM_001025247.1Protein Accession#
NP_001020418.1Gene Name
TAF5L
Gene Alias
PAF65B
Gene Description
TAF5-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor, 65kDa
Gene Ontology
HyperlinkGene Summary
The product of this gene belongs to the WD-repeat TAF5 family of proteins. This gene encodes a protein that is a component of the PCAF histone acetylase complex. The PCAF histone acetylase complex, which is composed of more than 20 polypeptides some of which are TAFs, is required for myogenic transcription and differentiation. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors to facilitate complex assembly and transcription initiation. The encoded protein is structurally similar to one of the histone-like TAFs, TAF5. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000037470|OTTHUMP00000037471|PCAF associated factor 65 beta|TAF5-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor, 65 kD
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com