KCNMB3 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant KCNMB3.
Immunogen
KCNMB3 (NP_741979, 82 a.a. ~ 181 a.a) partial recombinant protein with GST tag.
Sequence
FMLSIQREESTCTAIHTDIMDDWLDCAFTCGVHCHGQGKYPCLQVFVNLSHPGQKALLHYNEEAVQINPKCFYTPKCHQDRNDLLNSALDIKEFFDHKNG
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (70); Rat (77)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.11 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
ELISA
-
Gene Info — KCNMB3
Entrez GeneID
27094GeneBank Accession#
NM_171828Protein Accession#
NP_741979Gene Name
KCNMB3
Gene Alias
KCNMB2, KCNMBL
Gene Description
potassium large conductance calcium-activated channel, subfamily M beta member 3
Omim ID
605222Gene Ontology
HyperlinkGene Summary
MaxiK channels are large conductance, voltage and calcium-sensitive potassium channels which are fundamental to the control of smooth muscle tone and neuronal excitability. MaxiK channels can be formed by 2 subunits: the pore-forming alpha subunit and the modulatory beta subunit. The protein encoded by this gene is an auxiliary beta subunit which may partially inactivate or slightly decrease the activation time of MaxiK alpha subunit currents. Alternative splicing results in multiple transcript variants. A related pseudogene has been identified on chromosome 22. [provided by RefSeq
Other Designations
calcium-activated potassium channel beta 3 subunit|large conductance, voltage and Ca2+ activated potassium channel Maxi K beta 3 subunit|potassium large conductance calcium-activated channel beta 3 subunit
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Accelerated Ca2+ entry by membrane hyperpolarization due to Ca2+-activated K+ channel activation in response to histamine in chondrocytes.
Funabashi K, Ohya S, Yamamura H, Hatano N, Muraki K, Giles W, Imaizumi Y.
American Journal of Physiology. Cell Physiology 2010 Apr; 298(4):C786.
Application:IF, WB-Ce, Human, OUMS-27 cells.
-
Gender difference in BK channel expression in amygdala complex of rat brain.
Ohno A, Ohya S, Yamamura H, Imaizumi Y.
Biochemical and Biophysical Research Communications 2008 Dec; 378(4):867.
Application:IF, Rat, Rat pyramidal-like cells.
-
Differential distribution of Ca(2+)-activated potassium channel beta4 subunit in rat brain: Immunolocalization in neuronal mitochondria.
Piwonska M, WilczekE, Szewczyk A, Wilczynski GM.
Neuroscience 2008 Feb; 153(2):446.
Application:WB, Rat, Rat brain mitochondria.
-
Accelerated Ca2+ entry by membrane hyperpolarization due to Ca2+-activated K+ channel activation in response to histamine in chondrocytes.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com