B3GAT1 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human B3GAT1 partial ORF ( NP_061114, 235 a.a. - 332 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
AGKVVRWKTVFDPHRPFAIDMAGFAVNLRLILQRSQAYFKLRGVKGGYQESSLLRELVTLNDLEPKAANCTKILVWHTRTEKPVLVNEGKKGFTDPSV
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.52
Interspecies Antigen Sequence
Mouse (98); Rat (98)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — B3GAT1
Entrez GeneID
27087GeneBank Accession#
NM_018644Protein Accession#
NP_061114Gene Name
B3GAT1
Gene Alias
CD57, GLCATP, GlcAT-P, GlcUAT-P, HNK-1, HNK1, LEU7, NK-1
Gene Description
beta-1,3-glucuronyltransferase 1 (glucuronosyltransferase P)
Omim ID
151290Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the glucuronyltransferase gene family. These enzymes exhibit strict acceptor specificity, recognizing nonreducing terminal sugars and their anomeric linkages. This gene product functions as the key enzyme in a glucuronyl transfer reaction during the biosynthesis of the carbohydrate epitope HNK-1 (human natural killer-1, also known as CD57 and LEU7). Alternate transcriptional splice variants have been characterized. [provided by RefSeq
Other Designations
CD57 antigen|LEU7 antigen|UDP-GlcUA:glycoprotein beta-1,3-glucuronyltransferase|beta-1,3-glucuronyltransferase 1|galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 1|glucuronosyltransferase P
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com